PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi3g37700.1.p
Common NameBRADI_3g37700
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family Nin-like
Protein Properties Length: 154aa    MW: 17485.9 Da    PI: 6.232
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi3g37700.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK36.69.1e-1259102750
            RWP-RK   7 ledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkik 50 
                       l+++ +y +lp+ +AAkeL++ + +LK   R++GI+ WP  +ik
  Bradi3g37700.1.p  59 LDEILRYLHLPMVEAAKELKMTPKALKHLSRRHGINPWPTQRIK 102
                       678999**********************************9998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151911.35440124IPR003035RWP-RK domain
PfamPF020426.4E-1159102IPR003035RWP-RK domain
Sequence ? help Back to Top
Protein Sequence    Length: 154 aa     Download sequence    Send to blast
MDHFQVTILE SSLVDESNDG LVVVPMPVAP PATWNENPHA DMQHDKGTIV EQHERDDMLD  60
EILRYLHLPM VEAAKELKMT PKALKHLSRR HGINPWPTQR IKATNKNITK LLDAGTHGNN  120
KREASIQFKN MDLEKNKEEM HEKIATQSAE PEI*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLI1I7N71e-110I1I7N7_BRADI; Uncharacterized protein
STRINGBRADI3G37700.11e-110(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP5019822
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24020.12e-09NIN like protein 7